Lineage for d2brsb_ (2brs B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2234694Protein Eosinophil major basic protein [64457] (1 species)
  7. 2234695Species Human (Homo sapiens) [TaxId:9606] [64458] (2 PDB entries)
  8. 2234699Domain d2brsb_: 2brs B: [129017]
    automated match to d1h8ub_
    complexed with so4

Details for d2brsb_

PDB Entry: 2brs (more details), 2.2 Å

PDB Description: embp heparin complex
PDB Compounds: (B:) eosinophil-granule major basic protein

SCOPe Domain Sequences for d2brsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brsb_ d.169.1.1 (B:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]}
ryllvrslqtfsqawftcrrcyrgnlvsihnfninyriqcsvsalnqgqvwiggritgsg
rcrrfqwvdgsrwnfaywaahqpwsrgghcvalctrggywrrahclrrlpficsy

SCOPe Domain Coordinates for d2brsb_:

Click to download the PDB-style file with coordinates for d2brsb_.
(The format of our PDB-style files is described here.)

Timeline for d2brsb_: