SCOPe 2.06: Domain d2brsa_: 2brs A:

Lineage for d2brsa_ (2brs A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Eosinophil major basic protein [64457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64458] (2 PDB entries)

8. Domain d2brsa_: 2brs A: [129016]
   automated match to d1h8ub_
   complexed with so4

Details for d2brsa_

PDB Entry: 2brs, 2.2 Å

PDB Description: embp heparin complex

PDB Compounds: (A:) eosinophil-granule major basic protein

SCOPe Domain Sequences for d2brsa_:

Sequence; same for both SEQRES and ATOM records:

>d2brsa_ d.169.1.1 (A:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]}
ryllvrslqtfsqawftcrrcyrgnlvsihnfninyriqcsvsalnqgqvwiggritgsg
rcrrfqwvdgsrwnfaywaahqpwsrgghcvalctrggywrrahclrrlpficsy

Timeline for d2brsa_:

• d2brsa_ first appeared in SCOP 1.73, called d2brsa1
  
• d2brsa_ appears in SCOPe 2.05
  
• d2brsa_ appears in SCOPe 2.07
  
• d2brsa_ appears in the current release, SCOPe 2.08