Lineage for d2brsa_ (2brs A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001416Protein Eosinophil major basic protein [64457] (1 species)
  7. 3001417Species Human (Homo sapiens) [TaxId:9606] [64458] (2 PDB entries)
  8. 3001420Domain d2brsa_: 2brs A: [129016]
    automated match to d1h8ub_
    complexed with so4

Details for d2brsa_

PDB Entry: 2brs (more details), 2.2 Å

PDB Description: embp heparin complex
PDB Compounds: (A:) eosinophil-granule major basic protein

SCOPe Domain Sequences for d2brsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brsa_ d.169.1.1 (A:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]}
ryllvrslqtfsqawftcrrcyrgnlvsihnfninyriqcsvsalnqgqvwiggritgsg
rcrrfqwvdgsrwnfaywaahqpwsrgghcvalctrggywrrahclrrlpficsy

SCOPe Domain Coordinates for d2brsa_:

Click to download the PDB-style file with coordinates for d2brsa_.
(The format of our PDB-style files is described here.)

Timeline for d2brsa_: