Lineage for d2brrx2 (2brr X:108-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 655939Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655955Domain d2brrx2: 2brr X:108-214 [129014]
    Other proteins in same PDB: d2brrh1, d2brrl1, d2brrx1, d2brry1
    automatically matched to d1hzhl2
    complexed with acy, nh2, so4

Details for d2brrx2

PDB Entry: 2brr (more details), 1.95 Å

PDB Description: Complex of the neisserial PorA P1.4 epitope peptide and two Fab- fragments (antibody MN20B9.34)
PDB Compounds: (X:) mn20b9.34 anti-p1.4 antibody, fab light chain

SCOP Domain Sequences for d2brrx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brrx2 b.1.1.2 (X:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d2brrx2:

Click to download the PDB-style file with coordinates for d2brrx2.
(The format of our PDB-style files is described here.)

Timeline for d2brrx2: