SCOPe 2.08: Domain d2brrl1: 2brr L:1-107

Lineage for d2brrl1 (2brr L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries)

8. Domain d2brrl1: 2brr L:1-107 [129011]
   Other proteins in same PDB: d2brrh1, d2brrl2, d2brrx2, d2brry1
   automatically matched to d1hzhl1
   complexed with acy, so4

Details for d2brrl1

PDB Entry: 2brr, 1.95 Å

PDB Description: Complex of the neisserial PorA P1.4 epitope peptide and two Fab- fragments (antibody MN20B9.34)

PDB Compounds: (L:) mn20b9.34 anti-p1.4 antibody, fab light chain

SCOPe Domain Sequences for d2brrl1:

Sequence; same for both SEQRES and ATOM records:

>d2brrl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
envltqspaimsaspgekvtmtcrasssvsssylhwyqqksgaspklwiystsnlasgvp
arfsgsgsgtsysltissveaedaatyycqqysgypytfgggtkleik

Timeline for d2brrl1:

• d2brrl1 first appeared in SCOP 1.73
  
• d2brrl1 appears in SCOPe 2.07