Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (20 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.10: Filamin repeat (rod domain) [81290] (4 proteins) Pfam PF00630 |
Protein Filamin a [141023] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141024] (3 PDB entries) |
Domain d2brqb1: 2brq B:2236-2328 [129009] automatically matched to 2BRQ A:2236-2328 complexed with gol, gtt |
PDB Entry: 2brq (more details), 2.1 Å
SCOP Domain Sequences for d2brqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2brqb1 b.1.18.10 (B:2236-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv ayvvqepgdyevsvkfneehipdspfvvpvasp
Timeline for d2brqb1: