Lineage for d2brqb_ (2brq B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. Protein automated matches [190226] (79 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries)
  8. Domain d2brqb_: 2brq B: [129009]
    Other proteins in same PDB: d2brqa1
    automated match to d1v05a_
    complexed with gol, gsh

Details for d2brqb_

PDB Entry: 2brq (more details), 2.1 Å

PDB Description: Crystal structure of the filamin A repeat 21 complexed with the integrin beta7 cytoplasmic tail peptide
PDB Compounds: (B:) Filamin A

SCOPe Domain Sequences for d2brqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brqb_ b.1.18.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
ayvvqepgdyevsvkfneehipdspfvvpvasps

SCOPe Domain Coordinates for d2brqb_ are not available.

Timeline for d2brqb_:

Domains from other chains:
(mouse over for more information)
d2brqa1