SCOPe 2.08: Domain d2brqb_: 2brq B:

Lineage for d2brqb_ (2brq B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186988] (11 PDB entries)

8. Domain d2brqb_: 2brq B: [129009]
   Other proteins in same PDB: d2brqa1
   automated match to d1v05a_
   complexed with gol, gsh

Details for d2brqb_

PDB Entry: 2brq, 2.1 Å

PDB Description: Crystal structure of the filamin A repeat 21 complexed with the integrin beta7 cytoplasmic tail peptide

PDB Compounds: (B:) Filamin A

SCOPe Domain Sequences for d2brqb_:

Sequence; same for both SEQRES and ATOM records:

>d2brqb_ b.1.18.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
ayvvqepgdyevsvkfneehipdspfvvpvasps

Timeline for d2brqb_:

• d2brqb_ first appeared in SCOP 1.73, called d2brqb1
  
• d2brqb_ appears in SCOPe 2.07