Lineage for d2brqa1 (2brq A:2236-2328)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765751Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 2765765Protein Filamin a [141023] (1 species)
  7. 2765766Species Human (Homo sapiens) [TaxId:9606] [141024] (8 PDB entries)
    Uniprot P21333 1863-1953! Uniprot P21333 1863-1955! Uniprot P21333 2236-2328
  8. 2765771Domain d2brqa1: 2brq A:2236-2328 [129008]
    Other proteins in same PDB: d2brqb_
    21st repeat
    complexed with gol, gsh

Details for d2brqa1

PDB Entry: 2brq (more details), 2.1 Å

PDB Description: Crystal structure of the filamin A repeat 21 complexed with the integrin beta7 cytoplasmic tail peptide
PDB Compounds: (A:) Filamin A

SCOPe Domain Sequences for d2brqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brqa1 b.1.18.10 (A:2236-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]}
ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
ayvvqepgdyevsvkfneehipdspfvvpvasp

SCOPe Domain Coordinates for d2brqa1:

Click to download the PDB-style file with coordinates for d2brqa1.
(The format of our PDB-style files is described here.)

Timeline for d2brqa1: