Lineage for d2brpa3 (2brp A:541-814)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2375752Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2375891Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2376102Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 protein domains)
    automatically mapped to Pfam PF02278
  6. 2376120Protein Hyaluronate lyase [50009] (2 species)
  7. 2376121Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [50010] (18 PDB entries)
    Uniprot Q54873 287-1007
  8. 2376131Domain d2brpa3: 2brp A:541-814 [129007]
    Other proteins in same PDB: d2brpa1, d2brpa2
    automated match to d1w3ya3
    complexed with sie, so4, xls

Details for d2brpa3

PDB Entry: 2brp (more details), 2 Å

PDB Description: crystal structure of s. pneumoniae hyaluronate lyase in complex with w249b
PDB Compounds: (A:) hyaluronate lyase

SCOPe Domain Sequences for d2brpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brpa3 b.30.5.2 (A:541-814) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwytsdgmfylyngd
lshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddanatatmdftnw
nqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvyvndkeaslte
qekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegqsdkevenefl
tisqahkqngdsygymlipnvdratfnqmikele

SCOPe Domain Coordinates for d2brpa3:

Click to download the PDB-style file with coordinates for d2brpa3.
(The format of our PDB-style files is described here.)

Timeline for d2brpa3: