Lineage for d2brpa2 (2brp A:815-890)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662946Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 662947Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 662948Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 662966Protein Hyaluronate lyase [49867] (2 species)
  7. 662971Species Streptococcus pneumoniae [TaxId:1313] [49868] (18 PDB entries)
  8. 662983Domain d2brpa2: 2brp A:815-890 [129006]
    Other proteins in same PDB: d2brpa1, d2brpa3
    automatically matched to d1egua2
    complexed with sie, so4, xls

Details for d2brpa2

PDB Entry: 2brp (more details), 2 Å

PDB Description: crystal structure of s. pneumoniae hyaluronate lyase in complex with w249b
PDB Compounds: (A:) hyaluronate lyase

SCOP Domain Sequences for d2brpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brpa2 b.24.1.1 (A:815-890) Hyaluronate lyase {Streptococcus pneumoniae [TaxId: 1313]}
ssliennetlqsvydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayyn
petqesapdqevfkkl

SCOP Domain Coordinates for d2brpa2:

Click to download the PDB-style file with coordinates for d2brpa2.
(The format of our PDB-style files is described here.)

Timeline for d2brpa2: