![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
![]() | Superfamily c.73.1: Carbamate kinase-like [53633] (3 families) ![]() the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
![]() | Family c.73.1.3: PyrH-like [142721] (3 proteins) part of Pfam PF00696 |
![]() | Protein Uridylate kinase PyrH [142728] (6 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [142731] (3 PDB entries) Uniprot Q8U122 1-225 |
![]() | Domain d2brib1: 2bri B:1-225 [129000] automatically matched to 2BRX A:1-225 complexed with anp, mg |
PDB Entry: 2bri (more details), 3 Å
SCOP Domain Sequences for d2brib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2brib1 c.73.1.3 (B:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]} mrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfns setfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpghtt davaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekags ssvidplaakiiarsgiktivigkedakdlfrvikgdhngttiep
Timeline for d2brib1: