Lineage for d2brib1 (2bri B:1-225)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708177Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 708178Superfamily c.73.1: Carbamate kinase-like [53633] (3 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 708221Family c.73.1.3: PyrH-like [142721] (3 proteins)
    part of Pfam PF00696
  6. 708241Protein Uridylate kinase PyrH [142728] (6 species)
  7. 708263Species Pyrococcus furiosus [TaxId:2261] [142731] (3 PDB entries)
  8. 708269Domain d2brib1: 2bri B:1-225 [129000]
    automatically matched to 2BRX A:1-225
    complexed with anp, mg

Details for d2brib1

PDB Entry: 2bri (more details), 3 Å

PDB Description: ump kinase from pyrococcus furiosus complexed with its substrate analog amppnp
PDB Compounds: (B:) uridylate kinase

SCOP Domain Sequences for d2brib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brib1 c.73.1.3 (B:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]}
mrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfns
setfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpghtt
davaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekags
ssvidplaakiiarsgiktivigkedakdlfrvikgdhngttiep

SCOP Domain Coordinates for d2brib1:

Click to download the PDB-style file with coordinates for d2brib1.
(The format of our PDB-style files is described here.)

Timeline for d2brib1: