![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
![]() | Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) ![]() the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
![]() | Family c.73.1.3: PyrH-like [142721] (4 proteins) part of Pfam PF00696 |
![]() | Protein automated matches [190400] (4 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:2261] [187472] (4 PDB entries) |
![]() | Domain d2brib_: 2bri B: [129000] automated match to d2bmub_ complexed with anp, mg |
PDB Entry: 2bri (more details), 3 Å
SCOPe Domain Sequences for d2brib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2brib_ c.73.1.3 (B:) automated matches {Pyrococcus furiosus [TaxId: 2261]} mrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfns setfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpghtt davaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekags ssvidplaakiiarsgiktivigkedakdlfrvikgdhngttiep
Timeline for d2brib_: