Lineage for d2bria_ (2bri A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1872996Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 1872997Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 1873059Family c.73.1.3: PyrH-like [142721] (4 proteins)
    part of Pfam PF00696
  6. 1873102Protein automated matches [190400] (4 species)
    not a true protein
  7. 1873127Species Pyrococcus furiosus [TaxId:2261] [187472] (4 PDB entries)
  8. 1873133Domain d2bria_: 2bri A: [128999]
    automated match to d2bmub_
    complexed with anp, mg

Details for d2bria_

PDB Entry: 2bri (more details), 3 Å

PDB Description: ump kinase from pyrococcus furiosus complexed with its substrate analog amppnp
PDB Compounds: (A:) uridylate kinase

SCOPe Domain Sequences for d2bria_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bria_ c.73.1.3 (A:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfns
setfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpghtt
davaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekags
ssvidplaakiiarsgiktivigkedakdlfrvikgdhngttiep

SCOPe Domain Coordinates for d2bria_:

Click to download the PDB-style file with coordinates for d2bria_.
(The format of our PDB-style files is described here.)

Timeline for d2bria_: