SCOPe 2.04: Domain d2bria_: 2bri A:

Lineage for d2bria_ (2bri A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (4 proteins)
   part of Pfam PF00696

6. Protein automated matches [190400] (4 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [187472] (4 PDB entries)

8. Domain d2bria_: 2bri A: [128999]
   automated match to d2bmub_
   complexed with anp, mg

Details for d2bria_

PDB Entry: 2bri, 3 Å

PDB Description: ump kinase from pyrococcus furiosus complexed with its substrate analog amppnp

PDB Compounds: (A:) uridylate kinase

SCOPe Domain Sequences for d2bria_:

Sequence; same for both SEQRES and ATOM records:

>d2bria_ c.73.1.3 (A:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mrivfdiggsvlvpenpdidfikeiayqltkvsedhevavvvgggklarkyievaekfns
setfkdfigiqitranamlliaalrekaypvvvedfweawkavqlkkipvmggthpghtt
davaallaeflkadllvvitnvdgvytadpkkdptakkikkmkpeelleivgkgiekags
ssvidplaakiiarsgiktivigkedakdlfrvikgdhngttiep

Timeline for d2bria_:

• d2bria_ first appeared in SCOP 1.73, called d2bria1
  
• d2bria_ was called d2bria1 in SCOPe 2.03
  
• d2bria_ appears in SCOPe 2.05
  
• d2bria_ appears in the current release, SCOPe 2.08