Lineage for d2brfa1 (2brf A:8-108)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663035Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 663036Superfamily b.26.1: SMAD/FHA domain [49879] (4 families) (S)
    has a few short helices inserted in loops
  5. 663070Family b.26.1.2: FHA domain [49885] (11 proteins)
  6. 663118Protein Polynucleotide kinase 3'-phosphatase [101628] (2 species)
  7. 663119Species Human (Homo sapiens) [TaxId:9606] [141134] (1 PDB entry)
  8. 663120Domain d2brfa1: 2brf A:8-108 [128996]
    complexed with so4

Details for d2brfa1

PDB Entry: 2brf (more details), 1.4 Å

PDB Description: crystal structure of the fha domain of human polynucleotide kinase 3' phosphatase
PDB Compounds: (A:) bifunctional polynucleotide phosphatase/kinase

SCOP Domain Sequences for d2brfa1:

Sequence, based on SEQRES records: (download)

>d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]}
grlwlesppgeappiflpsdgqalvlgrgpltqvtdrkcsrtqvelvadpetrtvavkql
gvnpsttgtqelkpglegslgvgdtlylvnglhpltlrwee

Sequence, based on observed residues (ATOM records): (download)

>d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]}
grlwlesppgeappiflpsdgqalvlgrgpltqvtdrkcsrtqvelvadpetrtvavkql
gvnpsttgqelkpglegslgvgdtlylvnglhpltlrwee

SCOP Domain Coordinates for d2brfa1:

Click to download the PDB-style file with coordinates for d2brfa1.
(The format of our PDB-style files is described here.)

Timeline for d2brfa1: