Lineage for d2br5e1 (2br5 E:3-232)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 705246Family c.66.1.50: CmcI-like [142632] (1 protein)
    Pfam PF04989; may have evolved different enzymatic activity
  6. 705247Protein Cephalosporin hydroxylase CmcI [142633] (1 species)
  7. 705248Species Streptomyces clavuligerus [TaxId:1901] [142634] (5 PDB entries)
  8. 705276Domain d2br5e1: 2br5 E:3-232 [128991]
    automatically matched to 2BM8 A:2-233
    complexed with sah; mutant

Details for d2br5e1

PDB Entry: 2br5 (more details), 2.83 Å

PDB Description: cmci-n160 sah
PDB Compounds: (E:) cephalosporin hydroxylase cmci

SCOP Domain Sequences for d2br5e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2br5e1 c.66.1.50 (E:3-232) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]}
dysrqnfqdlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrglr
mlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsrc
qipasdmenitlhqgdcsdlttfehlremahplifidnahantfnimkwavdhlleegdy
fiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrv

SCOP Domain Coordinates for d2br5e1:

Click to download the PDB-style file with coordinates for d2br5e1.
(The format of our PDB-style files is described here.)

Timeline for d2br5e1: