Lineage for d2br5c_ (2br5 C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146397Family c.66.1.50: CmcI-like [142632] (1 protein)
    Pfam PF04989; may have evolved different enzymatic activity
  6. 2146398Protein Cephalosporin hydroxylase CmcI [142633] (1 species)
  7. 2146399Species Streptomyces clavuligerus [TaxId:1901] [142634] (5 PDB entries)
    Uniprot O85726 2-233
  8. 2146426Domain d2br5c_: 2br5 C: [128990]
    automated match to d2bm8a1
    complexed with sah

Details for d2br5c_

PDB Entry: 2br5 (more details), 2.83 Å

PDB Description: cmci-n160 sah
PDB Compounds: (C:) cephalosporin hydroxylase cmci

SCOPe Domain Sequences for d2br5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2br5c_ c.66.1.50 (C:) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]}
nfqdlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrglrmlkdp
dtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsrcqipas
dmenitlhqgdcsdlttfehlremahplifidnahantfnimkwavdhlleegdyfiied
mipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrvaa

SCOPe Domain Coordinates for d2br5c_:

Click to download the PDB-style file with coordinates for d2br5c_.
(The format of our PDB-style files is described here.)

Timeline for d2br5c_: