Lineage for d2br5a1 (2br5 A:8-233)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839581Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 839582Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) (S)
  5. 840337Family c.66.1.50: CmcI-like [142632] (1 protein)
    Pfam PF04989; may have evolved different enzymatic activity
  6. 840338Protein Cephalosporin hydroxylase CmcI [142633] (1 species)
  7. 840339Species Streptomyces clavuligerus [TaxId:1901] [142634] (5 PDB entries)
    Uniprot O85726 2-233
  8. 840364Domain d2br5a1: 2br5 A:8-233 [128988]
    automatically matched to 2BM8 A:2-233
    complexed with sah; mutant

Details for d2br5a1

PDB Entry: 2br5 (more details), 2.83 Å

PDB Description: cmci-n160 sah
PDB Compounds: (A:) cephalosporin hydroxylase cmci

SCOP Domain Sequences for d2br5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2br5a1 c.66.1.50 (A:8-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]}
nfqdlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrglrmlkdp
dtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsrcqipas
dmenitlhqgdcsdlttfehlremahplifidnahantfnimkwavdhlleegdyfiied
mipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrva

SCOP Domain Coordinates for d2br5a1:

Click to download the PDB-style file with coordinates for d2br5a1.
(The format of our PDB-style files is described here.)

Timeline for d2br5a1: