![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.50: CmcI-like [142632] (1 protein) Pfam PF04989; may have evolved different enzymatic activity |
![]() | Protein Cephalosporin hydroxylase CmcI [142633] (1 species) |
![]() | Species Streptomyces clavuligerus [TaxId:1901] [142634] (5 PDB entries) Uniprot O85726 2-233 |
![]() | Domain d2br3e_: 2br3 E: [128980] automated match to d2br3a1 complexed with 15p, mg, peg |
PDB Entry: 2br3 (more details), 2.79 Å
SCOPe Domain Sequences for d2br3e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2br3e_ c.66.1.50 (E:) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} ndysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrgl rmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsr cqipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleegd yfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrva
Timeline for d2br3e_: