SCOPe 2.05: Domain d2br3d_: 2br3 D:

Lineage for d2br3d_ (2br3 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.50: CmcI-like [142632] (1 protein)
   Pfam PF04989; may have evolved different enzymatic activity

6. Protein Cephalosporin hydroxylase CmcI [142633] (1 species)

7. Species Streptomyces clavuligerus [TaxId:1901] [142634] (5 PDB entries)
   Uniprot O85726 2-233

8. Domain d2br3d_: 2br3 D: [128979]
   automated match to d2br3a1
   complexed with 15p, mg, peg

Details for d2br3d_

PDB Entry: 2br3, 2.79 Å

PDB Description: cmci-d160 mg

PDB Compounds: (D:) cephalosporin hydroxylase cmci

SCOPe Domain Sequences for d2br3d_:

Sequence; same for both SEQRES and ATOM records:

>d2br3d_ c.66.1.50 (D:) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]}
ndysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrgl
rmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsr
cqipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleegd
yfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrr

Timeline for d2br3d_:

• d2br3d_ first appeared in SCOP 1.73, called d2br3d1
  
• d2br3d_ appears in SCOPe 2.04
  
• d2br3d_ appears in SCOPe 2.06
  
• d2br3d_ appears in the current release, SCOPe 2.08