Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.50: CmcI-like [142632] (1 protein) Pfam PF04989; may have evolved different enzymatic activity |
Protein Cephalosporin hydroxylase CmcI [142633] (1 species) |
Species Streptomyces clavuligerus [TaxId:1901] [142634] (5 PDB entries) Uniprot O85726 2-233 |
Domain d2br3a1: 2br3 A:2-233 [128976] complexed with 15p, mg, peg |
PDB Entry: 2br3 (more details), 2.79 Å
SCOPe Domain Sequences for d2br3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2br3a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} ndysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrgl rmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsr cqipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleegd yfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrva
Timeline for d2br3a1: