Lineage for d2br0a2 (2br0 A:1-240)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2623694Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 2623695Protein DinB homolog (DBH) [100889] (3 species)
  7. 2623705Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (41 PDB entries)
  8. 2623723Domain d2br0a2: 2br0 A:1-240 [128974]
    Other proteins in same PDB: d2br0a1
    automated match to d2v4ra1
    complexed with ca, dg

Details for d2br0a2

PDB Entry: 2br0 (more details), 2.17 Å

PDB Description: dna adduct bypass polymerization by sulfolobus solfataricus dpo4. analysis and crystal structures of multiple base-pair substitution and frameshift products with the adduct 1,n2-ethenoguanine
PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2br0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2br0a2 e.8.1.7 (A:1-240) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

SCOPe Domain Coordinates for d2br0a2:

Click to download the PDB-style file with coordinates for d2br0a2.
(The format of our PDB-style files is described here.)

Timeline for d2br0a2: