![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
![]() | Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) ![]() |
![]() | Family d.240.1.0: automated matches [231323] (1 protein) not a true family |
![]() | Protein automated matches [231324] (5 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:273057] [231327] (33 PDB entries) |
![]() | Domain d2br0a1: 2br0 A:241-342 [128973] Other proteins in same PDB: d2br0a2 automated match to d2v4ra2 complexed with ca, dg |
PDB Entry: 2br0 (more details), 2.17 Å
SCOPe Domain Sequences for d2br0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2br0a1 d.240.1.0 (A:241-342) automated matches {Sulfolobus solfataricus [TaxId: 273057]} vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr tfphgisketaysesvkllqkileederkirrigvrfskfie
Timeline for d2br0a1: