Lineage for d2br0a1 (2br0 A:241-341)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740696Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 740697Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 740698Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 740699Protein DinB homolog (DBH) [100881] (2 species)
  7. 740704Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (41 PDB entries)
  8. 740725Domain d2br0a1: 2br0 A:241-341 [128973]
    Other proteins in same PDB: d2br0a2
    automatically matched to d1n48a1
    complexed with ca, dg3, gne

Details for d2br0a1

PDB Entry: 2br0 (more details), 2.17 Å

PDB Description: dna adduct bypass polymerization by sulfolobus solfataricus dpo4. analysis and crystal structures of multiple base-pair substitution and frameshift products with the adduct 1,n2-ethenoguanine
PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d2br0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2br0a1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOP Domain Coordinates for d2br0a1:

Click to download the PDB-style file with coordinates for d2br0a1.
(The format of our PDB-style files is described here.)

Timeline for d2br0a1: