Lineage for d2bqua2 (2bqu A:2-240)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743030Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 743031Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 743539Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 743540Protein DinB homolog (DBH) [100889] (2 species)
  7. 743546Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (41 PDB entries)
  8. 743580Domain d2bqua2: 2bqu A:2-240 [128968]
    Other proteins in same PDB: d2bqua1
    automatically matched to d1jx4a2
    complexed with ca, dad, gne

Details for d2bqua2

PDB Entry: 2bqu (more details), 2.5 Å

PDB Description: dna adduct bypass polymerization by sulfolobus solfataricus dpo4. analysis and crystal structures of multiple base-pair substitution and frameshift products with the adduct 1,n2-ethenoguanine
PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d2bqua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bqua2 e.8.1.7 (A:2-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
ivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagipi
veakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyrea
ynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldia
dvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

SCOP Domain Coordinates for d2bqua2:

Click to download the PDB-style file with coordinates for d2bqua2.
(The format of our PDB-style files is described here.)

Timeline for d2bqua2: