Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) |
Family d.240.1.0: automated matches [231323] (1 protein) not a true family |
Protein automated matches [231324] (4 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:273057] [231327] (33 PDB entries) |
Domain d2bqra1: 2bqr A:241-341 [128965] Other proteins in same PDB: d2bqra2 automated match to d2v4ra2 complexed with ca, dtp |
PDB Entry: 2bqr (more details), 2.37 Å
SCOPe Domain Sequences for d2bqra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bqra1 d.240.1.0 (A:241-341) automated matches {Sulfolobus solfataricus [TaxId: 273057]} vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr tfphgisketaysesvkllqkileederkirrigvrfskfi
Timeline for d2bqra1: