SCOPe 2.06: Domain d2bqra1: 2bqr A:241-341

Lineage for d2bqra1 (2bqr A:241-341)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.0: automated matches [231323] (1 protein)
   not a true family

6. Protein automated matches [231324] (4 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [231327] (33 PDB entries)

8. Domain d2bqra1: 2bqr A:241-341 [128965]
   Other proteins in same PDB: d2bqra2
   automated match to d2v4ra2
   complexed with ca, dtp

Details for d2bqra1

PDB Entry: 2bqr, 2.37 Å

PDB Description: dna adduct bypass polymerization by sulfolobus solfataricus dpo4. analysis and crystal structures of multiple base-pair substitution and frameshift products with the adduct 1,n2-ethenoguanine

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2bqra1:

Sequence; same for both SEQRES and ATOM records:

>d2bqra1 d.240.1.0 (A:241-341) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d2bqra1:

• d2bqra1 first appeared in SCOP 1.73
  
• d2bqra1 appears in SCOPe 2.05
  
• d2bqra1 appears in SCOPe 2.07
  
• d2bqra1 appears in the current release, SCOPe 2.08