Lineage for d2bqra1 (2bqr A:241-341)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881225Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 881226Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 881227Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 881228Protein DinB homolog (DBH) [100881] (3 species)
  7. 881233Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (50 PDB entries)
  8. 881263Domain d2bqra1: 2bqr A:241-341 [128965]
    Other proteins in same PDB: d2bqra2
    automatically matched to d1n48a1
    complexed with ca, dtp, gne

Details for d2bqra1

PDB Entry: 2bqr (more details), 2.37 Å

PDB Description: dna adduct bypass polymerization by sulfolobus solfataricus dpo4. analysis and crystal structures of multiple base-pair substitution and frameshift products with the adduct 1,n2-ethenoguanine
PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d2bqra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bqra1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOP Domain Coordinates for d2bqra1:

Click to download the PDB-style file with coordinates for d2bqra1.
(The format of our PDB-style files is described here.)

Timeline for d2bqra1: