SCOP 1.73: Domain d2bq1j1: 2bq1 J:6-286

Lineage for d2bq1j1 (2bq1 J:6-286)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (8 species)

7. Species Salmonella typhimurium [TaxId:90371] [47259] (3 PDB entries)

8. Domain d2bq1j1: 2bq1 J:6-286 [128958]
   Other proteins in same PDB: d2bq1e1, d2bq1e2, d2bq1f1, d2bq1f2
   automatically matched to d2r2fa_
   complexed with dgt, fe, mg

Details for d2bq1j1

PDB Entry: 2bq1, 4 Å

PDB Description: Ribonucleotide reductase class 1b holocomplex R1E,R2F from Salmonella typhimurium

PDB Compounds: (J:) ribonucleoside-diphosphate reductase 2 beta subunit

SCOP Domain Sequences for d2bq1j1:

Sequence; same for both SEQRES and ATOM records:

>d2bq1j1 a.25.1.2 (J:6-286) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 602]}
isainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgltl
ldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaayaws
eenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntadli
rliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyaetg
wvndvkaflcynankalmnlgyealfppemadvnpailaal

Timeline for d2bq1j1:

• d2bq1j1 is new in SCOP 1.73
  
• d2bq1j1 appears in SCOP 1.75
  
• d2bq1j1 appears in the current release, SCOPe 2.08