SCOPe 2.07: Domain d2bq1i1: 2bq1 I:6-288

Lineage for d2bq1i1 (2bq1 I:6-288)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (10 species)

7. Species Salmonella typhimurium [TaxId:90371] [47259] (3 PDB entries)

8. Domain d2bq1i1: 2bq1 I:6-288 [128957]
   Other proteins in same PDB: d2bq1e1, d2bq1e2, d2bq1f1, d2bq1f2
   automatically matched to d2r2fa_
   protein/DNA complex; complexed with dgt, fe, mg

Details for d2bq1i1

PDB Entry: 2bq1, 4 Å

PDB Description: Ribonucleotide reductase class 1b holocomplex R1E,R2F from Salmonella typhimurium

PDB Compounds: (I:) ribonucleoside-diphosphate reductase 2 beta subunit

SCOPe Domain Sequences for d2bq1i1:

Sequence; same for both SEQRES and ATOM records:

>d2bq1i1 a.25.1.2 (I:6-288) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 90371]}
isainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgltl
ldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaayaws
eenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntadli
rliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyaetg
wvndvkaflcynankalmnlgyealfppemadvnpailaalsp

Timeline for d2bq1i1:

• d2bq1i1 first appeared in SCOP 1.73
  
• d2bq1i1 appears in SCOPe 2.06
  
• d2bq1i1 appears in the current release, SCOPe 2.08