| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (9 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins) |
| Protein Ribonucleotide reductase R2 [47257] (9 species) |
| Species Salmonella typhimurium [TaxId:90371] [47259] (3 PDB entries) |
| Domain d2bq1i1: 2bq1 I:6-288 [128957] Other proteins in same PDB: d2bq1e1, d2bq1e2, d2bq1f1, d2bq1f2 automatically matched to d2r2fa_ complexed with dgt, fe, mg |
PDB Entry: 2bq1 (more details), 3.99 Å
SCOP Domain Sequences for d2bq1i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bq1i1 a.25.1.2 (I:6-288) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 90371]}
isainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgltl
ldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaayaws
eenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntadli
rliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyaetg
wvndvkaflcynankalmnlgyealfppemadvnpailaalsp
Timeline for d2bq1i1: