Lineage for d2bq1f1 (2bq1 F:13-174)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721200Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
    multihelical consists of two all-alpha subdomains
    subdomain 1 (residues 10-100) is a 4-helical bundle
  4. 2721201Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 2721202Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 2721203Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)
  7. 2721234Species Salmonella typhimurium [TaxId:90371] [109946] (5 PDB entries)
  8. 2721240Domain d2bq1f1: 2bq1 F:13-174 [128955]
    Other proteins in same PDB: d2bq1e2, d2bq1f2, d2bq1i1, d2bq1j1
    automatically matched to d1pema1
    protein/DNA complex; complexed with dgt, fe, mg

Details for d2bq1f1

PDB Entry: 2bq1 (more details), 4 Å

PDB Description: Ribonucleotide reductase class 1b holocomplex R1E,R2F from Salmonella typhimurium
PDB Compounds: (F:) ribonucleoside-diphosphate reductase 2 alpha subunit

SCOPe Domain Sequences for d2bq1f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bq1f1 a.98.1.1 (F:13-174) R1 subunit of ribonucleotide reductase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
tmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlvregyy
ddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfedrvtm
valtlaqgdetlatqltdemlsgrfqpatptflncgkqqrge

SCOPe Domain Coordinates for d2bq1f1:

Click to download the PDB-style file with coordinates for d2bq1f1.
(The format of our PDB-style files is described here.)

Timeline for d2bq1f1: