Lineage for d2bq1e2 (2bq1 E:175-699)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689699Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 689700Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (4 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 689726Family c.7.1.2: R1 subunit of ribonucleotide reductase, C-terminal domain [52002] (1 protein)
  6. 689727Protein R1 subunit of ribonucleotide reductase, C-terminal domain [52003] (2 species)
  7. 689751Species Salmonella typhimurium [TaxId:90371] [110447] (5 PDB entries)
  8. 689756Domain d2bq1e2: 2bq1 E:175-699 [128954]
    Other proteins in same PDB: d2bq1e1, d2bq1f1, d2bq1i1, d2bq1j1
    automatically matched to d1pema2
    complexed with dgt, fe, mg

Details for d2bq1e2

PDB Entry: 2bq1 (more details), 4 Å

PDB Description: Ribonucleotide reductase class 1b holocomplex R1E,R2F from Salmonella typhimurium
PDB Compounds: (E:) ribonucleoside-diphosphate reductase 2 alpha subunit

SCOP Domain Sequences for d2bq1e2:

Sequence, based on SEQRES records: (download)

>d2bq1e2 c.7.1.2 (E:175-699) R1 subunit of ribonucleotide reductase, C-terminal domain {Salmonella typhimurium [TaxId: 602]}
lvscfllriednmesigravnsalqlskrgggvafllsnlreagapikrienqssgvipv
mkmledafsyanqlgarqgagavylhahhpdilrfldtkrenadekiriktlslgvvipd
itfrlakenaqmalfspydiqrrygkpfgdiaiserydeliadphvrktyinardffqtl
aeiqfesgypyimfedtvnranpiagrinmsnlcseilqvnsasryddnldythighdis
cnlgslniahvmdspdigrtvetairgltavsdmshirsvpsiaagnaashaiglgqmnl
hgylaregiaygspealdftnlyfytitwhavhtsmrlarergktfagfaqsryasgdyf
tqylqddwqpktakvralfarsgitlptremwlklrddvmrygiynqnlqavpptgsisy
inhatssihpivakieirkegktgrvyypapfmtnenldmyqdaydigpekiidtyaeat
rhvdqglsltlffpdtattrdinkaqiyawrkgikslyyirlrql

Sequence, based on observed residues (ATOM records): (download)

>d2bq1e2 c.7.1.2 (E:175-699) R1 subunit of ribonucleotide reductase, C-terminal domain {Salmonella typhimurium [TaxId: 602]}
lvscfllriednmesigravnsalqlskrgggvafllsnlreagapikrienqssgvipv
mkmledafsyanqgagavylhahhpdilrfldtkriktlslgvvipditfrlakenaqma
lfspydiqrrygkpfgdiaiserydeliadphvrktyinardffqtlaeiqfesgypyim
fedtvnranpiagrinmsnlcseilqvnsasryddnldythighdiscnlgslniahvmd
spdigrtvetairgltavsdmshirsvpsiaagnaashaiglgqmnlhgylaregiaygs
pealdftnlyfytitwhavhtsmrlarergktfagfaqsryasgdyftqylqddwqpkta
kvralfarsgitlptremwlklrddvmrygiynqnlqavpptgsisyinhatssihpiva
kieirkegktgrvyypapfmtnenldmyqdaydigpekiidtyaeatrhvdqglsltlff
pdtattrdinkaqiyawrkgikslyyirlrql

SCOP Domain Coordinates for d2bq1e2:

Click to download the PDB-style file with coordinates for d2bq1e2.
(The format of our PDB-style files is described here.)

Timeline for d2bq1e2: