Lineage for d2bq1e1 (2bq1 E:13-174)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645525Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
    multihelical consists of two all-alpha subdomains
    subdomain 1 (residues 10-100) is a 4-helical bundle
  4. 645526Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 645527Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 645528Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)
  7. 645552Species Salmonella typhimurium [TaxId:90371] [109946] (5 PDB entries)
  8. 645557Domain d2bq1e1: 2bq1 E:13-174 [128953]
    Other proteins in same PDB: d2bq1e2, d2bq1f2, d2bq1i1, d2bq1j1
    automatically matched to d1pema1
    complexed with dgt, fe, mg

Details for d2bq1e1

PDB Entry: 2bq1 (more details), 4 Å

PDB Description: Ribonucleotide reductase class 1b holocomplex R1E,R2F from Salmonella typhimurium
PDB Compounds: (E:) ribonucleoside-diphosphate reductase 2 alpha subunit

SCOP Domain Sequences for d2bq1e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bq1e1 a.98.1.1 (E:13-174) R1 subunit of ribonucleotide reductase, N-terminal domain {Salmonella typhimurium [TaxId: 602]}
tmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlvregyy
ddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfedrvtm
valtlaqgdetlatqltdemlsgrfqpatptflncgkqqrge

SCOP Domain Coordinates for d2bq1e1:

Click to download the PDB-style file with coordinates for d2bq1e1.
(The format of our PDB-style files is described here.)

Timeline for d2bq1e1: