![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) multihelical consists of two all-alpha subdomains subdomain 1 (residues 10-100) is a 4-helical bundle |
![]() | Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) ![]() |
![]() | Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) |
![]() | Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [109946] (5 PDB entries) |
![]() | Domain d2bq1e1: 2bq1 E:13-174 [128953] Other proteins in same PDB: d2bq1e2, d2bq1f2, d2bq1i1, d2bq1j1 automatically matched to d1pema1 complexed with dgt, fe, mg |
PDB Entry: 2bq1 (more details), 4 Å
SCOP Domain Sequences for d2bq1e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bq1e1 a.98.1.1 (E:13-174) R1 subunit of ribonucleotide reductase, N-terminal domain {Salmonella typhimurium [TaxId: 602]} tmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlvregyy ddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfedrvtm valtlaqgdetlatqltdemlsgrfqpatptflncgkqqrge
Timeline for d2bq1e1:
![]() Domains from other chains: (mouse over for more information) d2bq1f1, d2bq1f2, d2bq1i1, d2bq1j1 |