Lineage for d2bpta_ (2bpt A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006920Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186980] (6 PDB entries)
  8. 2006921Domain d2bpta_: 2bpt A: [128951]
    automated match to d1qgka_

Details for d2bpta_

PDB Entry: 2bpt (more details), 1.99 Å

PDB Description: structure of the nup1p:kap95p complex
PDB Compounds: (A:) importin beta-1 subunit

SCOPe Domain Sequences for d2bpta_:

Sequence, based on SEQRES records: (download)

>d2bpta_ a.118.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
qaaafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
ayelaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaq
ncgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlm
ndqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinl
veqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsa
sistfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmg
lffrllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitav
gfiadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipy
lndimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtif
qfiaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlf
sqatkdtarwareqqkrqlsl

Sequence, based on observed residues (ATOM records): (download)

>d2bpta_ a.118.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
qaaafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
ayelaqfpqsplqsynfalssikdvvpnllnlltrqnededddwnvsmsagaclqlfaqn
cgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlmn
dqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinlv
eqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsas
istfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmgl
ffrllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitavg
fiadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipyl
ndimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtifq
fiaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlfs
qatkdtarwareqqkrqlsl

SCOPe Domain Coordinates for d2bpta_:

Click to download the PDB-style file with coordinates for d2bpta_.
(The format of our PDB-style files is described here.)

Timeline for d2bpta_: