Class a: All alpha proteins [46456] (289 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
Protein Cytochrome c3 [48697] (7 species) contains four heme groups |
Species Desulfovibrio vulgaris [TaxId:881] [48699] (18 PDB entries) Uniprot P00132 |
Domain d2bpna_: 2bpn A: [128950] automated match to d2ctha_ complexed with hec |
PDB Entry: 2bpn (more details)
SCOPe Domain Sequences for d2bpna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bpna_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio vulgaris [TaxId: 881]} apkapadglkmeatkqpvvfnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche
Timeline for d2bpna_: