Class a: All alpha proteins [46456] (284 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (73 PDB entries) Uniprot P20248 175-432 |
Domain d2bpmb2: 2bpm B:310-432 [128946] Other proteins in same PDB: d2bpma_, d2bpmc_ automated match to d1vywb2 complexed with 529, so4 |
PDB Entry: 2bpm (more details), 2.4 Å
SCOPe Domain Sequences for d2bpmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bpmb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet lnl
Timeline for d2bpmb2:
View in 3D Domains from other chains: (mouse over for more information) d2bpma_, d2bpmc_, d2bpmd1, d2bpmd2 |