Lineage for d2bpmb2 (2bpm B:309-432)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644042Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 644043Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 644044Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 644055Protein Cyclin A [47956] (2 species)
  7. 644056Species Cow (Bos taurus) [TaxId:9913] [47958] (19 PDB entries)
  8. 644092Domain d2bpmb2: 2bpm B:309-432 [128946]
    Other proteins in same PDB: d2bpma1, d2bpmc1
    automatically matched to d1vin_2
    complexed with 529, so4

Details for d2bpmb2

PDB Entry: 2bpm (more details), 2.4 Å

PDB Description: structure of cdk2-cyclin a with pha-630529
PDB Compounds: (B:) cyclin a2

SCOP Domain Sequences for d2bpmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpmb2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tlnl

SCOP Domain Coordinates for d2bpmb2:

Click to download the PDB-style file with coordinates for d2bpmb2.
(The format of our PDB-style files is described here.)

Timeline for d2bpmb2: