SCOPe 2.06: Domain d2bpmb1: 2bpm B:175-309

Lineage for d2bpmb1 (2bpm B:175-309)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
   Uniprot P20248 175-432

8. Domain d2bpmb1: 2bpm B:175-309 [128945]
   Other proteins in same PDB: d2bpma2, d2bpma3, d2bpmc2, d2bpmc3
   automated match to d1vywb1
   complexed with 529, so4

Details for d2bpmb1

PDB Entry: 2bpm, 2.4 Å

PDB Description: structure of cdk2-cyclin a with pha-630529

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d2bpmb1:

Sequence; same for both SEQRES and ATOM records:

>d2bpmb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

Timeline for d2bpmb1:

• d2bpmb1 first appeared in SCOP 1.73
  
• d2bpmb1 appears in SCOPe 2.05
  
• d2bpmb1 appears in SCOPe 2.07
  
• d2bpmb1 appears in the current release, SCOPe 2.08