Lineage for d2bpma1 (2bpm A:-3-298)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734916Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 734926Species Human (Homo sapiens) [TaxId:9606] [88856] (124 PDB entries)
  8. 735032Domain d2bpma1: 2bpm A:-3-298 [128944]
    Other proteins in same PDB: d2bpmb1, d2bpmb2, d2bpmd1, d2bpmd2
    automatically matched to d1vywa_
    complexed with 529, so4

Details for d2bpma1

PDB Entry: 2bpm (more details), 2.4 Å

PDB Description: structure of cdk2-cyclin a with pha-630529
PDB Compounds: (A:) Cell division protein kinase 2

SCOP Domain Sequences for d2bpma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpma1 d.144.1.7 (A:-3-298) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
plvdmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
rl

SCOP Domain Coordinates for d2bpma1:

Click to download the PDB-style file with coordinates for d2bpma1.
(The format of our PDB-style files is described here.)

Timeline for d2bpma1: