Lineage for d2bplc2 (2bpl C:1-240)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044571Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 1044617Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)
  7. 1044618Species Escherichia coli [TaxId:562] [56238] (5 PDB entries)
    Uniprot P17169 1-238
  8. 1044625Domain d2bplc2: 2bpl C:1-240 [128943]
    Other proteins in same PDB: d2bpla1, d2bplb1, d2bplc1
    automatically matched to d1jxaa2
    complexed with f6r

Details for d2bplc2

PDB Entry: 2bpl (more details), 2.05 Å

PDB Description: e coli glucosamine-6p synthase in complexe with fructose-6p
PDB Compounds: (C:) glucosamine--fructose-6-phosphate aminotransferase [isomerizing]

SCOPe Domain Sequences for d2bplc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bplc2 d.153.1.1 (C:1-240) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy

SCOPe Domain Coordinates for d2bplc2:

Click to download the PDB-style file with coordinates for d2bplc2.
(The format of our PDB-style files is described here.)

Timeline for d2bplc2: