SCOP 1.73: Domain d2bplb2: 2bpl B:1-240

Lineage for d2bplb2 (2bpl B:1-240)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
   has slightly different topology than other families do

6. Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)

7. Species Escherichia coli [TaxId:562] [56238] (5 PDB entries)

8. Domain d2bplb2: 2bpl B:1-240 [128941]
   Other proteins in same PDB: d2bpla1, d2bplb1, d2bplc1
   automatically matched to d1jxaa2
   complexed with f6r

Details for d2bplb2

PDB Entry: 2bpl, 2.05 Å

PDB Description: e coli glucosamine-6p synthase in complexe with fructose-6p

PDB Compounds: (B:) glucosamine--fructose-6-phosphate aminotransferase [isomerizing]

SCOP Domain Sequences for d2bplb2:

Sequence; same for both SEQRES and ATOM records:

>d2bplb2 d.153.1.1 (B:1-240) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy

Timeline for d2bplb2:

• d2bplb2 is new in SCOP 1.73
  
• d2bplb2 appears in SCOP 1.75
  
• d2bplb2 last appears in SCOPe 2.02