Lineage for d2bpla1 (2bpl A:241-608)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 709184Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 709185Superfamily c.80.1: SIS domain [53697] (3 families) (S)
  5. 709186Family c.80.1.1: double-SIS domain [53698] (4 proteins)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 709187Protein "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) [53699] (1 species)
  7. 709188Species Escherichia coli [TaxId:562] [53700] (6 PDB entries)
  8. 709191Domain d2bpla1: 2bpl A:241-608 [128938]
    Other proteins in same PDB: d2bpla2, d2bplb2, d2bplc2
    automatically matched to d1jxaa1
    complexed with f6r

Details for d2bpla1

PDB Entry: 2bpl (more details), 2.05 Å

PDB Description: e coli glucosamine-6p synthase in complexe with fructose-6p
PDB Compounds: (A:) glucosamine--fructose-6-phosphate aminotransferase [isomerizing]

SCOP Domain Sequences for d2bpla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpla1 c.80.1.1 (A:241-608) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]}
dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
klkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
laksvtve

SCOP Domain Coordinates for d2bpla1:

Click to download the PDB-style file with coordinates for d2bpla1.
(The format of our PDB-style files is described here.)

Timeline for d2bpla1: