SCOPe 2.08: Domain d2bp7h2: 2bp7 H:206-339

Lineage for d2bp7h2 (2bp7 H:206-339)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
   automatically mapped to Pfam PF02780

6. Protein automated matches [254490] (1 species)
   not a true protein
7. Species Pseudomonas putida [TaxId:303] [255059] (1 PDB entry)

8. Domain d2bp7h2: 2bp7 H:206-339 [128937]
   Other proteins in same PDB: d2bp7a_, d2bp7b1, d2bp7c_, d2bp7d1, d2bp7e_, d2bp7f1, d2bp7g_, d2bp7h1
   automated match to d1qs0b2

Details for d2bp7h2

PDB Entry: 2bp7, 2.9 Å

PDB Description: new crystal form of the pseudomonas putida branched-chain dehydrogenase (e1)

PDB Compounds: (H:) 2-oxoisovalerate dehydrogenase beta subunit

SCOPe Domain Sequences for d2bp7h2:

Sequence; same for both SEQRES and ATOM records:

>d2bp7h2 c.48.1.2 (H:206-339) automated matches {Pseudomonas putida [TaxId: 303]}
yytvpldkaaitrpgndvsvltygttvyvaqvaaeesgvdaevidlrslwpldldtives
vkktgrcvvvheatrtcgfgaelvslvqehcfhhleapiervtgwdtpyphaqewayfpg
psrvgaalkkvmev

Timeline for d2bp7h2:

• d2bp7h2 first appeared in SCOP 1.73
  
• d2bp7h2 appears in SCOPe 2.07