![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module automatically mapped to Pfam PF02779 |
![]() | Protein 2-oxoisovalerate dehydrogenase (E1B), Pyr module [88744] (1 species) chain A is alpha-subunit and chain B is beta-subunit |
![]() | Species Pseudomonas putida [TaxId:303] [88745] (2 PDB entries) |
![]() | Domain d2bp7h1: 2bp7 H:2-205 [128936] Other proteins in same PDB: d2bp7a_, d2bp7b2, d2bp7c_, d2bp7d2, d2bp7e_, d2bp7f2, d2bp7g_, d2bp7h2 automatically matched to d1qs0b1 |
PDB Entry: 2bp7 (more details), 2.9 Å
SCOPe Domain Sequences for d2bp7h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bp7h1 c.36.1.7 (H:2-205) 2-oxoisovalerate dehydrogenase (E1B), Pyr module {Pseudomonas putida [TaxId: 303]} atttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapis esgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmpc gggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyng pfdghhdrpvtpwskhphsavpdg
Timeline for d2bp7h1: