Lineage for d2bp7g_ (2bp7 G:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162387Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1162388Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1162856Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 1162906Protein automated matches [190098] (3 species)
    not a true protein
  7. 1162927Species Pseudomonas putida [TaxId:303] [186989] (1 PDB entry)
  8. 1162931Domain d2bp7g_: 2bp7 G: [128935]
    Other proteins in same PDB: d2bp7b1, d2bp7b2, d2bp7d1, d2bp7d2, d2bp7f1, d2bp7f2, d2bp7h1, d2bp7h2
    automated match to d1qs0a_

Details for d2bp7g_

PDB Entry: 2bp7 (more details), 2.9 Å

PDB Description: new crystal form of the pseudomonas putida branched-chain dehydrogenase (e1)
PDB Compounds: (G:) 2-oxoisovalerate dehydrogenase alpha subunit

SCOPe Domain Sequences for d2bp7g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bp7g_ c.36.1.11 (G:) automated matches {Pseudomonas putida [TaxId: 303]}
neyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvldeq
gdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqal
alnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagfftis
gnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvvn
nqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgpsl
iewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattaef
eaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqel

SCOPe Domain Coordinates for d2bp7g_:

Click to download the PDB-style file with coordinates for d2bp7g_.
(The format of our PDB-style files is described here.)

Timeline for d2bp7g_: