SCOP 1.73: Domain d2bp7e1: 2bp7 E:2-408

Lineage for d2bp7e1 (2bp7 E:2-408)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (4 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module

6. Protein 2-oxoisovalerate dehydrogenase (E1B), PP module [88769] (1 species)
   chain A is alpha-subunit and chain B is beta-subunit

7. Species Pseudomonas putida [TaxId:303] [88770] (2 PDB entries)

8. Domain d2bp7e1: 2bp7 E:2-408 [128932]
   Other proteins in same PDB: d2bp7b1, d2bp7b2, d2bp7d1, d2bp7d2, d2bp7f1, d2bp7f2, d2bp7h1, d2bp7h2
   automatically matched to d1qs0a_

Details for d2bp7e1

PDB Entry: 2bp7, 2.9 Å

PDB Description: new crystal form of the pseudomonas putida branched-chain dehydrogenase (e1)

PDB Compounds: (E:) 2-oxoisovalerate dehydrogenase alpha subunit

SCOP Domain Sequences for d2bp7e1:

Sequence; same for both SEQRES and ATOM records:

>d2bp7e1 c.36.1.11 (E:2-408) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]}
neyaplrlhvpeptgrpgcqtdfsylrlndagqarkppvdvdaadtadlsyslvrvldeq
gdaqgpwaedidpqilrqgmramlktrifdsrmvvaqrqkkmsfymqslgeeaigsgqal
alnrtdmcfptyrqqsilmardvslvemicqllsnerdplkgrqlpimysvreagfftis
gnlatqfvqavgwamasaikgdtkiasawigdgataesdfhtaltfahvyrapvilnvvn
nqwaistfqaiaggesttfagrgvgcgiaslrvdgndfvavyaasrwaaerarrglgpsl
iewvtyragphstsddpskyrpaddwshfplgdpiarlkqhlikighwseeehqattaef
eaaviaaqkeaeqygtlanghipsaasmfedvykempdhlrrqrqel

Timeline for d2bp7e1:

• d2bp7e1 is new in SCOP 1.73
  
• d2bp7e1 appears in SCOP 1.75
  
• d2bp7e1 appears in the current release, SCOPe 2.08, called d2bp7e_