Lineage for d2bp7b2 (2bp7 B:206-339)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880614Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2880615Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2880667Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
    automatically mapped to Pfam PF02780
  6. Protein automated matches [254490] (1 species)
    not a true protein
  7. Species Pseudomonas putida [TaxId:303] [255059] (1 PDB entry)
  8. 2880760Domain d2bp7b2: 2bp7 B:206-339 [128928]
    Other proteins in same PDB: d2bp7a_, d2bp7b1, d2bp7c_, d2bp7d1, d2bp7e_, d2bp7f1, d2bp7g_, d2bp7h1
    automated match to d1qs0b2

Details for d2bp7b2

PDB Entry: 2bp7 (more details), 2.9 Å

PDB Description: new crystal form of the pseudomonas putida branched-chain dehydrogenase (e1)
PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunit

SCOPe Domain Sequences for d2bp7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bp7b2 c.48.1.2 (B:206-339) automated matches {Pseudomonas putida [TaxId: 303]}
yytvpldkaaitrpgndvsvltygttvyvaqvaaeesgvdaevidlrslwpldldtives
vkktgrcvvvheatrtcgfgaelvslvqehcfhhleapiervtgwdtpyphaqewayfpg
psrvgaalkkvmev

SCOPe Domain Coordinates for d2bp7b2:

Click to download the PDB-style file with coordinates for d2bp7b2.
(The format of our PDB-style files is described here.)

Timeline for d2bp7b2: