Lineage for d2bp6d1 (2bp6 D:1-114)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679513Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 679514Superfamily b.115.1: Calcium-mediated lectin [82026] (1 family) (S)
  5. 679515Family b.115.1.1: Calcium-mediated lectin [82027] (2 proteins)
  6. 679516Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)
  7. 679517Species Pseudomonas aeruginosa [TaxId:287] [82029] (12 PDB entries)
  8. 679542Domain d2bp6d1: 2bp6 D:1-114 [128925]
    automatically matched to d1gzta_
    complexed with ca, gxl, so4

Details for d2bp6d1

PDB Entry: 2bp6 (more details), 1.5 Å

PDB Description: crystal structure of pseudomonas aeruginosa lectin (pa-iil) complexed with a-l-galactopyranoside
PDB Compounds: (D:) pseudomonas aeruginosa lectin II

SCOP Domain Sequences for d2bp6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bp6d1 b.115.1.1 (D:1-114) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOP Domain Coordinates for d2bp6d1:

Click to download the PDB-style file with coordinates for d2bp6d1.
(The format of our PDB-style files is described here.)

Timeline for d2bp6d1: