Lineage for d2bp5m1 (2bp5 M:159-435)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2768498Superfamily b.2.7: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49447] (2 families) (S)
    duplication: one domain of this fold is inserted into another domain of the same fold
  5. 2768499Family b.2.7.1: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49448] (1 protein)
    automatically mapped to Pfam PF00928
  6. 2768500Protein Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49449] (2 species)
  7. 2768503Species Norway rat (Rattus norvegicus) [TaxId:10116] [49450] (6 PDB entries)
  8. 2768508Domain d2bp5m1: 2bp5 M:159-435 [128921]
    automatically matched to d1bw8a_

Details for d2bp5m1

PDB Entry: 2bp5 (more details), 2.8 Å

PDB Description: mu2 adaptin subunit (ap50) of ap2 adaptor (second domain), complexed with non-canonical internalization peptide vedyeqglsg
PDB Compounds: (M:) clathrin coat assembly protein ap50

SCOPe Domain Sequences for d2bp5m1:

Sequence, based on SEQRES records: (download)

>d2bp5m1 b.2.7.1 (M:159-435) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd
kiviekqgkgtadetsksgkqsiaiddctfhqcvrlskfdsersisfippdgefelmryr
ttkdiilpfrviplvrevgrtklevkvviksnfkpsllaqkievriptplntsgvqvicm
kgkakykasenaivwkikrmagmkesqisaeiellptndkkkwarppismnfevpfapsg
lkvrylkvfepklnysdhdvikwvryigrsgiyetrc

Sequence, based on observed residues (ATOM records): (download)

>d2bp5m1 b.2.7.1 (M:159-435) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd
ksiaiddctfhqcvrlsersisfippdgefelmryrttkdiilpfrviplvrevgrtkle
vkvviksnfkpsllaqkievriptplntsgvqvicmkgkakykasenaivwkikrmagmk
esqisaeiellptndkkkwarppismnfevpfapsglkvrylkvfepklnysdhdvikwv
ryigrsgiyetrc

SCOPe Domain Coordinates for d2bp5m1:

Click to download the PDB-style file with coordinates for d2bp5m1.
(The format of our PDB-style files is described here.)

Timeline for d2bp5m1: